Recombinant Human GLDN Protein, GST-tagged

• Cat.No.: GLDN-1671H
• Product Overview: Human COLM partial ORF ( NP_861454, 131 a.a. - 240 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that contains olfactomedin-like and collagen-like domains. The encoded protein, which exists in both transmembrane and secreted forms, promotes formation of the nodes of Ranvier in the peripheral nervous system. Mutations in this gene cause a form of lethal congenital contracture syndrome in human patients. Autoantibodies to the encoded protein have been identified in sera form patients with multifocal motor neuropathy. [provided by RefSeq, May 2017]
• Molecular Mass: 37.84 kDa
• AA Sequence: SRRAKGPRQPSMFNGQCPGETCAIPNDDTLVGKADEKASEHHSPQAESMITSIGNPVQVLKVTETFGTWIRESANKSDDRIWVTEHFSGIMVKEFKDQPSLLNGSYTFIH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLDN gliomedin [ Homo sapiens ]
• Official Symbol: GLDN
• Synonyms: GLDN; gliomedin; collomin , COLM; CLOM; colmedin; CRG L2; UNC 112; collomin; COLM; CRGL2; CRG-L2; UNC-112; FLJ23917
• Gene ID: 342035
• mRNA Refseq: NM_181789
• Protein Refseq: NP_861454
• MIM: 608603
• UniProt ID: Q6ZMI3