Recombinant Human GLRX5 Protein, GST-tagged
| Cat.No. : | GLRX5-4978H |
| Product Overview : | Human GLRX5 full-length ORF ( NP_057501.2, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a mitochondrial protein, which is evolutionarily conserved. It is involved in the biogenesis of iron-sulfur clusters, which are required for normal iron homeostasis. Mutations in this gene are associated with autosomal recessive pyridoxine-refractory sideroblastic anemia. [provided by RefSeq, May 2010] |
| Molecular Mass : | 43 kDa |
| AA Sequence : | MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GLRX5 glutaredoxin 5 [ Homo sapiens ] |
| Official Symbol | GLRX5 |
| Synonyms | GLRX5; glutaredoxin 5; C14orf87, chromosome 14 open reading frame 87, glutaredoxin 5 homolog (S. cerevisiae); glutaredoxin-related protein 5, mitochondrial; GRX5; PR01238; glutaredoxin 5 homolog; monothiol glutaredoxin-5; FLB4739; PRO1238; C14orf87; MGC14129; |
| Gene ID | 51218 |
| mRNA Refseq | NM_016417 |
| Protein Refseq | NP_057501 |
| MIM | 609588 |
| UniProt ID | Q86SX6 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX5 Products
Required fields are marked with *
My Review for All GLRX5 Products
Required fields are marked with *



