Recombinant Human GLRX5 Protein, GST-tagged
Cat.No. : | GLRX5-4978H |
Product Overview : | Human GLRX5 full-length ORF ( NP_057501.2, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a mitochondrial protein, which is evolutionarily conserved. It is involved in the biogenesis of iron-sulfur clusters, which are required for normal iron homeostasis. Mutations in this gene are associated with autosomal recessive pyridoxine-refractory sideroblastic anemia. [provided by RefSeq, May 2010] |
Molecular Mass : | 43 kDa |
AA Sequence : | MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLRX5 glutaredoxin 5 [ Homo sapiens ] |
Official Symbol | GLRX5 |
Synonyms | GLRX5; glutaredoxin 5; C14orf87, chromosome 14 open reading frame 87, glutaredoxin 5 homolog (S. cerevisiae); glutaredoxin-related protein 5, mitochondrial; GRX5; PR01238; glutaredoxin 5 homolog; monothiol glutaredoxin-5; FLB4739; PRO1238; C14orf87; MGC14129; |
Gene ID | 51218 |
mRNA Refseq | NM_016417 |
Protein Refseq | NP_057501 |
MIM | 609588 |
UniProt ID | Q86SX6 |
◆ Recombinant Proteins | ||
GLRX5-5349HF | Recombinant Full Length Human GLRX5 Protein, GST-tagged | +Inquiry |
GLRX5-1696R | Recombinant Rhesus Macaque GLRX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRX5-2398H | Recombinant Human Glutaredoxin 5, His-tagged | +Inquiry |
GLRX5-6425M | Recombinant Mouse GLRX5 Protein | +Inquiry |
GLRX5-1876R | Recombinant Rhesus monkey GLRX5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX5-5896HCL | Recombinant Human GLRX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX5 Products
Required fields are marked with *
My Review for All GLRX5 Products
Required fields are marked with *