Recombinant Human GMFG Protein, GST-tagged

• Cat.No.: GMFG-5011H
• Product Overview: Human GMFG full-length ORF ( NP_004868.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GMFG (Glia Maturation Factor Gamma) is a Protein Coding gene. Among its related pathways are GPCR Pathway and Phospholipase-C Pathway. GO annotations related to this gene include actin binding and enzyme activator activity. An important paralog of this gene is GMFB.
• Molecular Mass: 43.2 kDa
• AA Sequence: MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GMFG glia maturation factor, gamma [ Homo sapiens ]
• Official Symbol: GMFG
• Synonyms: GMFG; glia maturation factor, gamma; glia maturation factor gamma; GMF-GAMMA; MGC126867
• Gene ID: 9535
• mRNA Refseq: NM_004877
• Protein Refseq: NP_004868
• MIM: 604104
• UniProt ID: O60234