Recombinant Human GMFG Protein, GST-tagged
| Cat.No. : | GMFG-5011H |
| Product Overview : | Human GMFG full-length ORF ( NP_004868.1, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GMFG (Glia Maturation Factor Gamma) is a Protein Coding gene. Among its related pathways are GPCR Pathway and Phospholipase-C Pathway. GO annotations related to this gene include actin binding and enzyme activator activity. An important paralog of this gene is GMFB. |
| Molecular Mass : | 43.2 kDa |
| AA Sequence : | MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GMFG glia maturation factor, gamma [ Homo sapiens ] |
| Official Symbol | GMFG |
| Synonyms | GMFG; glia maturation factor, gamma; glia maturation factor gamma; GMF-GAMMA; MGC126867; |
| Gene ID | 9535 |
| mRNA Refseq | NM_004877 |
| Protein Refseq | NP_004868 |
| MIM | 604104 |
| UniProt ID | O60234 |
| ◆ Recombinant Proteins | ||
| GMFG-5011H | Recombinant Human GMFG Protein, GST-tagged | +Inquiry |
| GMFG-2586R | Recombinant Rat GMFG Protein | +Inquiry |
| GMFG-13334H | Recombinant Human GMFG, GST-tagged | +Inquiry |
| GMFG-299H | Recombinant Human GMFG protein, His-tagged | +Inquiry |
| Gmfg-3247M | Recombinant Mouse Gmfg Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GMFG-5882HCL | Recombinant Human GMFG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GMFG Products
Required fields are marked with *
My Review for All GMFG Products
Required fields are marked with *
