Recombinant Human GNG4 protein, GST-tagged
| Cat.No. : | GNG4-13364H |
| Product Overview : | Recombinant Human GNG4 protein(1-75 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | August 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-75 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GNG4 guanine nucleotide binding protein (G protein), gamma 4 [ Homo sapiens ] |
| Official Symbol | GNG4 |
| Synonyms | GNG4; guanine nucleotide binding protein (G protein), gamma 4; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4; guanine nucleotide binding protein 4; FLJ23803; FLJ34187; DKFZp547K1018; |
| Gene ID | 2786 |
| mRNA Refseq | NM_001098721 |
| Protein Refseq | NP_001092191 |
| MIM | 604388 |
| UniProt ID | P50150 |
| ◆ Recombinant Proteins | ||
| GNG4-3775M | Recombinant Mouse GNG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Gng4-1036M | Recombinant Mouse Gng4 Protein, MYC/DDK-tagged | +Inquiry |
| GNG4-1950H | Recombinant Human GNG4 Protein, MYC/DDK-tagged | +Inquiry |
| GNG4-422H | Recombinant Human guanine nucleotide binding protein (G protein), gamma 4, His-tagged | +Inquiry |
| GNG4-939H | Recombinant Human GNG4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG4 Products
Required fields are marked with *
My Review for All GNG4 Products
Required fields are marked with *
