Recombinant Human GNPDA1 protein, T7/His-tagged
Cat.No. : | GNPDA1-236H |
Product Overview : | Recombinant human GNPDA1 cDNA (2–289 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 2-289 a.a. |
Form : | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLG CYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFE EKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMDAR EVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSI KEKETEKSQSSKKPYSD |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ] |
Official Symbol | GNPDA1 |
Synonyms | GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin; GNPDA 1; glcN6P deaminase 1; GNP1; GNPI; |
Gene ID | 10007 |
mRNA Refseq | NM_005471 |
Protein Refseq | NP_005462 |
MIM | 601798 |
UniProt ID | P46926 |
Chromosome Location | 5q21 |
Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; N-acetylglucosamine degradation I, organism-specific biosystem; N-acetylglucosamine degradation II, organism-specific biosystem; UDP-N-acetyl-D-galactosamine biosynthesis II, organism-specific biosystem; |
Function | glucosamine-6-phosphate deaminase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
GNPDA1-3782M | Recombinant Mouse GNPDA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNPDA1-2589Z | Recombinant Zebrafish GNPDA1 | +Inquiry |
GNPDA1-13375H | Recombinant Human GNPDA1, GST-tagged | +Inquiry |
GNPDA1-29090TH | Recombinant Human GNPDA1, His-tagged | +Inquiry |
GNPDA1-5402HF | Recombinant Full Length Human GNPDA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPDA1-724HCL | Recombinant Human GNPDA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPDA1 Products
Required fields are marked with *
My Review for All GNPDA1 Products
Required fields are marked with *
0
Inquiry Basket