Recombinant Human GNPDA1 protein, T7/His-tagged

Cat.No. : GNPDA1-236H
Product Overview : Recombinant human GNPDA1 cDNA (2–289 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-289 a.a.
Form : 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLG CYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFE EKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMDAR EVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSI KEKETEKSQSSKKPYSD
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ]
Official Symbol GNPDA1
Synonyms GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin; GNPDA 1; glcN6P deaminase 1; GNP1; GNPI;
Gene ID 10007
mRNA Refseq NM_005471
Protein Refseq NP_005462
MIM 601798
UniProt ID P46926
Chromosome Location 5q21
Pathway Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; N-acetylglucosamine degradation I, organism-specific biosystem; N-acetylglucosamine degradation II, organism-specific biosystem; UDP-N-acetyl-D-galactosamine biosynthesis II, organism-specific biosystem;
Function glucosamine-6-phosphate deaminase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNPDA1 Products

Required fields are marked with *

My Review for All GNPDA1 Products

Required fields are marked with *

0
cart-icon