Recombinant Human GNPDA1 protein, T7/His-tagged
| Cat.No. : | GNPDA1-236H |
| Product Overview : | Recombinant human GNPDA1 cDNA (2–289 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 2-289 a.a. |
| Form : | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLG CYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFE EKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMDAR EVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSI KEKETEKSQSSKKPYSD |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ] |
| Official Symbol | GNPDA1 |
| Synonyms | GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin; GNPDA 1; glcN6P deaminase 1; GNP1; GNPI; |
| Gene ID | 10007 |
| mRNA Refseq | NM_005471 |
| Protein Refseq | NP_005462 |
| MIM | 601798 |
| UniProt ID | P46926 |
| Chromosome Location | 5q21 |
| Pathway | Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; N-acetylglucosamine degradation I, organism-specific biosystem; N-acetylglucosamine degradation II, organism-specific biosystem; UDP-N-acetyl-D-galactosamine biosynthesis II, organism-specific biosystem; |
| Function | glucosamine-6-phosphate deaminase activity; hydrolase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPDA1 Products
Required fields are marked with *
My Review for All GNPDA1 Products
Required fields are marked with *



