"GNPDA1" Related Products

Expand
Expand
Expand

Recombinant Human GNPDA1 protein, T7/His-tagged

Cat.No.: GNPDA1-236H
Product Overview: Recombinant human GNPDA1 cDNA (2–289 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLG CYKKLIEYYKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFE EKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMDAR EVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSI KEKETEKSQSSKKPYSD
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: GNPDA1 glucosamine-6-phosphate deaminase 1 [ Homo sapiens ]
Official Symbol: GNPDA1
Synonyms: GNPDA1; glucosamine-6-phosphate deaminase 1; glucosamine 6 phosphate isomerase , GNPI; glucosamine-6-phosphate isomerase 1; glucosamine 6 phosphate deaminase; GNPDA; GPI; HLN; KIAA0060; oscillin; GNPDA 1; glcN6P deaminase 1; GNP1; GNPI;
Gene ID: 10007
mRNA Refseq: NM_005471
Protein Refseq: NP_005462
MIM: 601798
UniProt ID: P46926
Chromosome Location: 5q21
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; N-acetylglucosamine degradation I, organism-specific biosystem; N-acetylglucosamine degradation II, organism-specific biosystem; UDP-N-acetyl-D-galactosamine biosynthesis II, organism-specific biosystem;
Function: glucosamine-6-phosphate deaminase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.