Recombinant Human GNRH1 Protein
Cat.No. : | GNRH1-060H |
Product Overview : | Recombinant human GNRH1 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 92 |
Description : | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. |
Form : | Lyophilized |
Molecular Mass : | 1.182 kDa |
AA Sequence : | MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst). |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | GNRH1 gonadotropin releasing hormone 1 [ Homo sapiens (human) ] |
Official Symbol | GNRH1 |
Synonyms | GNRH1; gonadotropin releasing hormone 1; GRH; GNRH; LHRH; LNRH; progonadoliberin-1; GnRH-associated peptide 1; gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); leuteinizing-releasing hormone; luliberin I; prolactin release-inhibiting factor |
Gene ID | 2796 |
mRNA Refseq | NM_000825 |
Protein Refseq | NP_000816 |
MIM | 152760 |
UniProt ID | P01148 |
◆ Recombinant Proteins | ||
GNRH1-2269R | Recombinant Rat GNRH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNRH1-219H | Recombinant Human GNRH1, His-tagged | +Inquiry |
Gnrh1-1042M | Recombinant Mouse Gnrh1 Protein, MYC/DDK-tagged | +Inquiry |
GNRH1-306H | Human Gonadotropin-releasing Hormone 1 (Luteinizing-releasing Hormone) | +Inquiry |
GNRH1-5408HF | Recombinant Full Length Human GNRH1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNRH1-5839HCL | Recombinant Human GNRH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNRH1 Products
Required fields are marked with *
My Review for All GNRH1 Products
Required fields are marked with *
0
Inquiry Basket