Recombinant Full Length Human GNRH1 Protein, GST-tagged
Cat.No. : | GNRH1-5408HF |
Product Overview : | Human GNRH1 full-length ORF ( NP_000816.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 92 amino acids |
Description : | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 35.75 kDa |
AA Sequence : | MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNRH1 gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) [ Homo sapiens ] |
Official Symbol | GNRH1 |
Synonyms | GNRH1; gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); GNRH, gonadotropin releasing hormone 1 (leutinizing releasing hormone), GRH, LHRH; progonadoliberin-1; luliberin I; progonadoliberin I; GnRH-associated peptide 1; prolactin release-inhibiting factor; gonadotropin-releasing hormone 1 (leutinizing-releasing hormone); GRH; GNRH; LHRH; LNRH; |
Gene ID | 2796 |
mRNA Refseq | NM_000825 |
Protein Refseq | NP_000816 |
MIM | 152760 |
UniProt ID | P01148 |
◆ Recombinant Proteins | ||
GNRH1-1004H | Recombinant Human GNRH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gnrh1-1042M | Recombinant Mouse Gnrh1 Protein, MYC/DDK-tagged | +Inquiry |
GNRH1-5408HF | Recombinant Full Length Human GNRH1 Protein, GST-tagged | +Inquiry |
GNRH1-134H | Recombinant Human Gonadotropin-releasing Hormone 1 | +Inquiry |
GNRH1-1915R | Recombinant Rhesus monkey GNRH1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNRH1-5839HCL | Recombinant Human GNRH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNRH1 Products
Required fields are marked with *
My Review for All GNRH1 Products
Required fields are marked with *