Recombinant Human GOLGA2 Protein, GST-tagged
Cat.No. : | GOLGA2-01H |
Product Overview : | Human GOLGA2 partial ORF (AAH06381.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. |
Molecular Mass : | 38.94 kDa |
AA Sequence : | EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV |
Applications : | Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GOLGA2 golgin A2 [ Homo sapiens (human) ] |
Official Symbol | GOLGA2 |
Synonyms | GOLGA2; golgin A2; GM130; golgin subfamily A member 2; 130 kDa cis-Golgi matrix protein; GM130 autoantigen; Golgi matrix protein GM130; SY11 protein; golgi autoantigen, golgin subfamily a, 2; golgin-95 |
Gene ID | 2801 |
mRNA Refseq | NM_004486 |
Protein Refseq | NP_004477 |
MIM | 602580 |
UniProt ID | Q08379 |
◆ Recombinant Proteins | ||
GOLGA2-6782Z | Recombinant Zebrafish GOLGA2 | +Inquiry |
GOLGA2-5421HF | Recombinant Full Length Human GOLGA2 Protein, GST-tagged | +Inquiry |
GOLGA2-5105H | Recombinant Human GOLGA2 Protein, GST-tagged | +Inquiry |
GOLGA2-3291H | Recombinant Human GOLGA2 Protein (Ala361-Ala678), N-His tagged | +Inquiry |
GOLGA2-29029TH | Recombinant Human GOLGA2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOLGA2-726HCL | Recombinant Human GOLGA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GOLGA2 Products
Required fields are marked with *
My Review for All GOLGA2 Products
Required fields are marked with *
0
Inquiry Basket