Recombinant Human GOLGB1 Protein, GST-tagged

Cat.No. : GOLGB1-5111H
Product Overview : Human GOLGB1 partial ORF ( NP_004478, 3 a.a. - 91 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GOLGB1 (Golgin B1) is a Protein Coding gene. Diseases associated with GOLGB1 include Blue Cone Monochromacy and Pedophilia. Among its related pathways are Clathrin derived vesicle budding and Vesicle-mediated transport. GO annotations related to this gene include poly(A) RNA binding and sequence-specific DNA binding.
Molecular Mass : 35.53 kDa
AA Sequence : SRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GOLGB1 golgin B1 [ Homo sapiens ]
Official Symbol GOLGB1
Synonyms GOLGB1; golgin B1; golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal), 1, golgin B1, golgi integral membrane protein; Golgin subfamily B member 1; GCP; GCP372; giantin; golgi integral membrane protein 1; GOLIM1; macrogolgin; 372 kDa Golgi complex-associated protein; golgin B1, golgi integral membrane protein; golgi autoantigen, golgin subfamily b, macrogolgin (with transmembrane signal), 1; FLJ37232; DKFZp686F09142;
Gene ID 2804
mRNA Refseq NM_001256487
Protein Refseq NP_001243416
MIM 602500
UniProt ID Q14789

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GOLGB1 Products

Required fields are marked with *

My Review for All GOLGB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon