Recombinant Human GOT2 Protein, GST-tagged
Cat.No. : | GOT2-5128H |
Product Overview : | Human GOT2 full-length ORF ( AAH00525.1, 1 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq |
Molecular Mass : | 73.9 kDa |
AA Sequence : | MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GOT2 glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) [ Homo sapiens ] |
Official Symbol | GOT2 |
Synonyms | GOT2; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); aspartate aminotransferase, mitochondrial; KAT4; KATIV; kynurenine aminotransferase IV; mitAAT; FABP-1; FABPpm; mAspAT; transaminase A; fatty acid-binding protein; glutamate oxaloacetate transaminase 2; plasma membrane-associated fatty acid-binding protein; FLJ40994; |
Gene ID | 2806 |
mRNA Refseq | NM_002080 |
Protein Refseq | NP_002071 |
MIM | 138150 |
UniProt ID | P00505 |
◆ Recombinant Proteins | ||
Got2-3669M | Recombinant Mouse Got2, His-tagged | +Inquiry |
GOT2-3534H | Recombinant Human GOT2 protein, His&Myc-tagged | +Inquiry |
GOT2-303C | Recombinant Cynomolgus Monkey GOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GOT2-7071C | Recombinant Chicken GOT2 | +Inquiry |
GOT2-5128H | Recombinant Human GOT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOT2-302HCL | Recombinant Human GOT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GOT2 Products
Required fields are marked with *
My Review for All GOT2 Products
Required fields are marked with *