Recombinant Human GPR176 Protein, GST-tagged

Cat.No. : GPR176-5164H
Product Overview : Human GPR partial ORF ( NP_009154, 416 a.a. - 515 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Members of the G protein-coupled receptor family, such as GPR176, are cell surface receptors involved in responses to hormones, growth factors, and neurotransmitters (Hata et al., 1995 [PubMed 7893747]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : PQFAPSAPPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKVSIFPKVDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR176 G protein-coupled receptor 176 [ Homo sapiens ]
Official Symbol GPR176
Synonyms GPR; Gm1012; GPR176; G protein-coupled receptor 176
Gene ID 11245
mRNA Refseq NM_007223
Protein Refseq NP_009154
MIM 612183
UniProt ID Q14439

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR176 Products

Required fields are marked with *

My Review for All GPR176 Products

Required fields are marked with *

0
cart-icon
0
compare icon