Recombinant Human GPR176 Protein, GST-tagged
Cat.No. : | GPR176-5164H |
Product Overview : | Human GPR partial ORF ( NP_009154, 416 a.a. - 515 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the G protein-coupled receptor family, such as GPR176, are cell surface receptors involved in responses to hormones, growth factors, and neurotransmitters (Hata et al., 1995 [PubMed 7893747]).[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PQFAPSAPPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRNSKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKVSIFPKVDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR176 G protein-coupled receptor 176 [ Homo sapiens ] |
Official Symbol | GPR176 |
Synonyms | GPR; Gm1012; GPR176; G protein-coupled receptor 176 |
Gene ID | 11245 |
mRNA Refseq | NM_007223 |
Protein Refseq | NP_009154 |
MIM | 612183 |
UniProt ID | Q14439 |
◆ Recombinant Proteins | ||
RFL4736RF | Recombinant Full Length Rat Probable G-Protein Coupled Receptor 176(Gpr176) Protein, His-Tagged | +Inquiry |
GPR176-1770R | Recombinant Rhesus Macaque GPR176 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPR176-2659R | Recombinant Rat GPR176 Protein | +Inquiry |
GPR176-6994Z | Recombinant Zebrafish GPR176 | +Inquiry |
GPR176-2313R | Recombinant Rat GPR176 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR176-744HCL | Recombinant Human GPR176 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR176 Products
Required fields are marked with *
My Review for All GPR176 Products
Required fields are marked with *