Recombinant Human GPR37L1 Protein, GST-tagged

Cat.No. : GPR37L1-5239H
Product Overview : Human GPR37L1 partial ORF ( NP_004758, 27 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GPR37L1 (G Protein-Coupled Receptor 37 Like 1) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity and G-protein coupled peptide receptor activity. An important paralog of this gene is GPR37.
Molecular Mass : 37.18 kDa
AA Sequence : PLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR37L1 G protein-coupled receptor 37 like 1 [ Homo sapiens ]
Official Symbol GPR37L1
Synonyms GPR37L1; G protein-coupled receptor 37 like 1; endothelin B receptor-like protein 2; ETBR LP 2; G-protein coupled receptor 37 like 1; G-protein coupled receptor 37-like 1; endothelin type b receptor-like protein 2; ETBR-LP-2; ET(B)R-LP-2;
Gene ID 9283
mRNA Refseq NM_004767
Protein Refseq NP_004758
MIM 617630
UniProt ID O60883

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPR37L1 Products

Required fields are marked with *

My Review for All GPR37L1 Products

Required fields are marked with *

0
cart-icon