Recombinant Human GPR37L1 Protein, GST-tagged
Cat.No. : | GPR37L1-5239H |
Product Overview : | Human GPR37L1 partial ORF ( NP_004758, 27 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GPR37L1 (G Protein-Coupled Receptor 37 Like 1) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include G-protein coupled receptor activity and G-protein coupled peptide receptor activity. An important paralog of this gene is GPR37. |
Molecular Mass : | 37.18 kDa |
AA Sequence : | PLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPDKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPR37L1 G protein-coupled receptor 37 like 1 [ Homo sapiens ] |
Official Symbol | GPR37L1 |
Synonyms | GPR37L1; G protein-coupled receptor 37 like 1; endothelin B receptor-like protein 2; ETBR LP 2; G-protein coupled receptor 37 like 1; G-protein coupled receptor 37-like 1; endothelin type b receptor-like protein 2; ETBR-LP-2; ET(B)R-LP-2; |
Gene ID | 9283 |
mRNA Refseq | NM_004767 |
Protein Refseq | NP_004758 |
MIM | 617630 |
UniProt ID | O60883 |
◆ Cell & Tissue Lysates | ||
GPR37L1-5786HCL | Recombinant Human GPR37L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPR37L1 Products
Required fields are marked with *
My Review for All GPR37L1 Products
Required fields are marked with *
0
Inquiry Basket