Recombinant Human GRAMD2A Protein
| Cat.No. : | GRAMD2A-5030H |
| Product Overview : | Human GRAMD2 full-length ORF (AAI60185.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | GRAMD2A (GRAM Domain Containing 2A) is a Protein Coding gene. An important paralog of this gene is GRAMD2B. |
| Form : | Liquid |
| Molecular Mass : | 39 kDa |
| AA Sequence : | MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKCGREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFGKDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFFPSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPRSTGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GRAMD2A GRAM domain containing 2A [ Homo sapiens (human) ] |
| Official Symbol | GRAMD2A |
| Synonyms | GRAMD2; GRAM domain containing 2; GRAM domain-containing protein 2; |
| Gene ID | 196996 |
| mRNA Refseq | NM_001012642 |
| Protein Refseq | NP_001012660 |
| UniProt ID | Q8IUY3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRAMD2A Products
Required fields are marked with *
My Review for All GRAMD2A Products
Required fields are marked with *



