Recombinant Human GRAMD4 protein, His-tagged
Cat.No. : | GRAMD4-2910H |
Product Overview : | Recombinant Human GRAMD4 protein(479-578 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 479-578 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | PTDYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVLSVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GRAMD4 GRAM domain containing 4 [ Homo sapiens ] |
Official Symbol | GRAMD4 |
Synonyms | DIP; dA59H18.1; dJ439F8.1 |
Gene ID | 23151 |
mRNA Refseq | NM_015124.3 |
Protein Refseq | NP_055939.1 |
MIM | 613691 |
UniProt ID | Q6IC98 |
◆ Recombinant Proteins | ||
GRAMD4-2910H | Recombinant Human GRAMD4 protein, His-tagged | +Inquiry |
RFL15937XF | Recombinant Full Length Xenopus Laevis Gram Domain-Containing Protein 4(Gramd4) Protein, His-Tagged | +Inquiry |
GRAMD4-3074H | Recombinant Human GRAMD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12302HF | Recombinant Full Length Human Gram Domain-Containing Protein 4(Gramd4) Protein, His-Tagged | +Inquiry |
GRAMD4-1198H | Recombinant Human GRAMD4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRAMD4-5759HCL | Recombinant Human GRAMD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRAMD4 Products
Required fields are marked with *
My Review for All GRAMD4 Products
Required fields are marked with *