Recombinant Human GRIP1 Protein, GST-tagged
Cat.No. : | GRIP1-12H |
Product Overview : | Recombinant Human GRIP1(851 a.a. - 950 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 851 a.a. - 950 a.a. |
Description : | This gene encodes a member of the glutamate receptor interacting protein family. The encoded scaffold protein binds to and mediates the trafficking and membrane organization of a number of transmembrane proteins. Alternatively spliced transcript variants encoding different isoforms have been described. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QSGILRELEATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GRIP1 glutamate receptor interacting protein 1 [ Homo sapiens ] |
Official Symbol | GRIP1 |
Synonyms | GRIP1; glutamate receptor interacting protein 1; glutamate receptor-interacting protein 1; GRIP; |
Gene ID | 23426 |
mRNA Refseq | NM_001178074 |
Protein Refseq | NP_001171545 |
MIM | 604597 |
UniProt ID | Q9Y3R0 |
◆ Recombinant Proteins | ||
GRIP1-113H | Recombinant Human GRIP1 protein, His-tagged | +Inquiry |
GRIP1-2361R | Recombinant Rat GRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRIP1-1747H | Recombinant Human GRIP1 protein, His & T7-tagged | +Inquiry |
GRIP1-2863H | Recombinant Human GRIP1 Protein (Gly874-Glu1073), N-His tagged | +Inquiry |
GRIP1-2707R | Recombinant Rat GRIP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRIP1-5741HCL | Recombinant Human GRIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRIP1 Products
Required fields are marked with *
My Review for All GRIP1 Products
Required fields are marked with *