Recombinant Human Growth Hormone Receptor, Fc Chimera

• Cat.No.: GHR-450H
• Product Overview: Recombinant Human Growth Hormone Receptor encoding the signal peptide and extracellular domain of human growth hormone receptor (GH R; aa 1-254) was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 1-254 a.a.
• Description: Human growth hormone receptor (GH R) is a type I membrane protein and is a member of the class I cytokine receptor family. GH R is highly expressed in the liver and in skeletal muscle as well as in the kidney, bladder, adrenal gland, brain, bone, cartilage, lung and stomach. Activation of GH R by GH regulates an extensive variety of physiological functions relating to human growth and metabolism. Specifically, binding of GH to GH R promotes the growth of bone, cartilage, and soft tissues, which occurs maximally during puberty. GH R activation also enhances the levels of hormones and neurotransmitters in the CNS, including IGF-1 and somatostatin.
• Amino Acid Sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
• Molecular Mass: Growth Hormone Receptor-Fc Chimera migrates as a broad band between 65 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation.
• pI: Growth Hormone Receptor-Fc Chimera separates into a number of isoforms with a pI between 5.0 and 7.7 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified GH R-Fc Chimera that has a predicted pI of 6.90.
• % Carbohydrate: Purified Growth Hormone Receptor-Fc Chimera consists of 15-35% carbohydrate by weight.
• Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

Gene Information

• Gene Name: GHR growth hormone receptor [ Homo sapiens ]
• Synonyms: GHR; growth hormone receptor; GHBP; serum binding protein; somatotropin receptor; growth hormone binding protein
• Gene ID: 2690
• mRNA Refseq: NM_000163
• Protein Refseq: NP_000154
• UniProt ID: P10912
• Chromosome Location: 5p14-p12
• MIM: 600946
• Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Neuroactive ligand-receptor interaction
• Function: SH2 domain binding; growth hormone receptor activity; peptide hormone binding; phosphate binding; oline-rich region binding; otein kinase binding; receptor activity