Recombinant Human GSTM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | GSTM2-1939H | 
| Product Overview : | GSTM2 MS Standard C13 and N15-labeled recombinant protein (NP_000839) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. | 
| Molecular Mass : | 25.7 kDa | 
| AA Sequence : | MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWSLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | GSTM2 glutathione S-transferase mu 2 [ Homo sapiens (human) ] | 
| Official Symbol | GSTM2 | 
| Synonyms | GSTM2; glutathione S-transferase mu 2 (muscle); glutathione S transferase M2 (muscle); glutathione S-transferase Mu 2; GST4; GST, muscle; GST class-mu 2; glutathione S-transferase 4; glutathione S-transferase M1; glutathione S-aryltransferase M2; glutathione S-alkyltransferase M2; glutathione S-aralkyltransferase M2; S-(hydroxyalkyl)glutathione lyase M2; glutathione S-transferase M2 (muscle); GSTM; GTHMUS; GSTM2-2; MGC117303; | 
| Gene ID | 2946 | 
| mRNA Refseq | NM_000848 | 
| Protein Refseq | NP_000839 | 
| MIM | 138380 | 
| UniProt ID | P28161 | 
| ◆ Recombinant Proteins | ||
| GSTM2-2522H | Recombinant Human GSTM2 protein, His-tagged | +Inquiry | 
| GSTM2-1992R | Recombinant Rhesus monkey GSTM2 Protein, His-tagged | +Inquiry | 
| GSTM2-321C | Recombinant Cynomolgus Monkey GSTM2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Gstm2-736R | Recombinant Rat Gstm2 protein, His-tagged | +Inquiry | 
| GSTM2-794H | Recombinant Human Glutathione S-transferase Mu 2 (Muscle), His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GSTM2-5712HCL | Recombinant Human GSTM2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTM2 Products
Required fields are marked with *
My Review for All GSTM2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            