Recombinant Human GUCA1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GUCA1A-1746H |
Product Overview : | GUCA1A MS Standard C13 and N15-labeled recombinant protein (NP_000400) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 22.9 kDa |
AA Sequence : | MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GUCA1A guanylate cyclase activator 1A [ Homo sapiens (human) ] |
Official Symbol | GUCA1A |
Synonyms | GUCA1A; guanylate cyclase activator 1A (retina); C6orf131, chromosome 6 open reading frame 131, GUCA, GUCA1; guanylyl cyclase-activating protein 1; COD3; cone dystrophy 3; dJ139D8.6; GCAP; GCAP1; GCAP 1; guanylin 1, retina; guanylate cyclase-activating protein, photoreceptor 1; GUCA; GUCA1; CORD14; C6orf131; |
Gene ID | 2978 |
mRNA Refseq | NM_000409 |
Protein Refseq | NP_000400 |
MIM | 600364 |
UniProt ID | P43080 |
◆ Recombinant Proteins | ||
GUCA1A-1746H | Recombinant Human GUCA1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GUCA1A-487H | Recombinant Human GUCA1A, His-GST tagged | +Inquiry |
GUCA1A-5893C | Recombinant Chicken GUCA1A | +Inquiry |
GUCA1A-7383M | Recombinant Mouse GUCA1A Protein | +Inquiry |
GUCA1A-2549H | Recombinant Human GUCA1A Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA1A-001HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
GUCA1A-002HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA1A Products
Required fields are marked with *
My Review for All GUCA1A Products
Required fields are marked with *
0
Inquiry Basket