Recombinant Human GUCA2B Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | GUCA2B-368H |
Product Overview : | GUCA2B MS Standard C13 and N15-labeled recombinant protein (NP_009033) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 12.1 kDa |
AA Sequence : | MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GUCA2B guanylate cyclase activator 2B (uroguanylin) [ Homo sapiens (human) ] |
Official Symbol | GUCA2B |
Synonyms | GUCA2B; guanylate cyclase activator 2B (uroguanylin); guanylate cyclase activator 2B; uroguanylin; UGN; GCAP-II; |
Gene ID | 2981 |
mRNA Refseq | NM_007102 |
Protein Refseq | NP_009033 |
MIM | 601271 |
UniProt ID | Q16661 |
◆ Recombinant Proteins | ||
GUCA2B-5396G | Recombinant Guinea pig GUCA2B protein | +Inquiry |
Guca2b-1606M | Recombinant Mouse Guca2b Protein, His-tagged | +Inquiry |
GUCA2B-5395G | Recombinant Guinea pig GUCA2B protein | +Inquiry |
GUCA2B-5098H | Recombinant Human GUCA2B protein, His-tagged | +Inquiry |
GUCA2B-1650H | Recombinant Human GUCA2B Protein (27-112 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA2B-767HCL | Recombinant Human GUCA2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA2B Products
Required fields are marked with *
My Review for All GUCA2B Products
Required fields are marked with *