Recombinant Mouse GUCA2B Protein (22-106 aa), GST-tagged
Cat.No. : | GUCA2B-544M |
Product Overview : | Recombinant Mouse GUCA2B Protein (22-106 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-106 aa |
Description : | Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 36.4 kDa |
AA Sequence : | VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Guca2b guanylate cyclase activator 2b (retina) [ Mus musculus ] |
Official Symbol | GUCA2B |
Synonyms | GUCA2B; Ugn; Gcap2; AV066530; |
Gene ID | 14916 |
mRNA Refseq | NM_008191 |
Protein Refseq | NP_032217 |
UniProt ID | O09051 |
◆ Recombinant Proteins | ||
GUCA2B-368H | Recombinant Human GUCA2B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GUCA2B-3706H | Recombinant Human GUCA2B | +Inquiry |
Guca2b-1078M | Recombinant Mouse Guca2b Protein, MYC/DDK-tagged | +Inquiry |
GUCA2B-2547H | Recombinant Human GUCA2B Protein, MYC/DDK-tagged | +Inquiry |
GUCA2B-5393G | Recombinant Guinea pig GUCA2B protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA2B-767HCL | Recombinant Human GUCA2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCA2B Products
Required fields are marked with *
My Review for All GUCA2B Products
Required fields are marked with *