Recombinant Human GUCY2D Protein, GST-tagged
Cat.No. : | GUCY2D-4493H |
Product Overview : | Human GUCY2D partial ORF ( NP_000171, 521 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a retina-specific guanylate cyclase, which is a member of the membrane guanylyl cyclase family. Like other membrane guanylyl cyclases, this enzyme has a hydrophobic amino-terminal signal sequence followed by a large extracellular domain, a single membrane spanning domain, a kinase homology domain, and a guanylyl cyclase catalytic domain. In contrast to other membrane guanylyl cyclases, this enzyme is not activated by natriuretic peptides. Mutations in this gene result in Leber congenital amaurosis and cone-rod dystrophy-6 diseases. [provided by RefSeq |
Molecular Mass : | 37.73 kDa |
AA Sequence : | RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GUCY2D guanylate cyclase 2D, membrane (retina-specific) [ Homo sapiens ] |
Official Symbol | GUCY2D |
Synonyms | GUCY2D; guanylate cyclase 2D, membrane (retina-specific); cone rod dystrophy 5/6 , CORD5, CORD6, GUC1A4, GUC2D, LCA; retinal guanylyl cyclase 1; CYGD; LCA1; retGC; RETGC 1; ROS GC1; ROS-GC; guanylate cyclase 2D, retinal; rod outer segment membrane guanylate cyclase; LCA; RCD2; CORD5; CORD6; GUC2D; ROSGC; GUC1A4; RETGC-1; ROS-GC1; |
Gene ID | 3000 |
mRNA Refseq | NM_000180 |
Protein Refseq | NP_000171 |
MIM | 600179 |
UniProt ID | Q02846 |
◆ Recombinant Proteins | ||
GUCY2D-182H | Recombinant Human GUCY2D Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GUCY2D-1033H | Recombinant Human GUCY2D Protein, His (Fc)-Avi-tagged | +Inquiry |
GUCY2D-2548H | Recombinant Human GUCY2D Protein, MYC/DDK-tagged | +Inquiry |
GUCY2D-1519H | Recombinant Human GUCY2D protein, His-Avi-tagged, Biotinylated | +Inquiry |
GUCY2D-2757R | Recombinant Rat GUCY2D Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUCY2D Products
Required fields are marked with *
My Review for All GUCY2D Products
Required fields are marked with *
0
Inquiry Basket