Recombinant Human GUCY2D Protein, GST-tagged

Cat.No. : GUCY2D-4493H
Product Overview : Human GUCY2D partial ORF ( NP_000171, 521 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a retina-specific guanylate cyclase, which is a member of the membrane guanylyl cyclase family. Like other membrane guanylyl cyclases, this enzyme has a hydrophobic amino-terminal signal sequence followed by a large extracellular domain, a single membrane spanning domain, a kinase homology domain, and a guanylyl cyclase catalytic domain. In contrast to other membrane guanylyl cyclases, this enzyme is not activated by natriuretic peptides. Mutations in this gene result in Leber congenital amaurosis and cone-rod dystrophy-6 diseases. [provided by RefSeq
Molecular Mass : 37.73 kDa
AA Sequence : RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUCY2D guanylate cyclase 2D, membrane (retina-specific) [ Homo sapiens ]
Official Symbol GUCY2D
Synonyms GUCY2D; guanylate cyclase 2D, membrane (retina-specific); cone rod dystrophy 5/6 , CORD5, CORD6, GUC1A4, GUC2D, LCA; retinal guanylyl cyclase 1; CYGD; LCA1; retGC; RETGC 1; ROS GC1; ROS-GC; guanylate cyclase 2D, retinal; rod outer segment membrane guanylate cyclase; LCA; RCD2; CORD5; CORD6; GUC2D; ROSGC; GUC1A4; RETGC-1; ROS-GC1;
Gene ID 3000
mRNA Refseq NM_000180
Protein Refseq NP_000171
MIM 600179
UniProt ID Q02846

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GUCY2D Products

Required fields are marked with *

My Review for All GUCY2D Products

Required fields are marked with *

0
cart-icon