Recombinant Human GUK1 Protein (AA 1-198), N-His-Tagged
Cat.No. : | GUK1-31H |
Product Overview : | Recombinant Human GUK1 Protein (AA 1-198) with a N-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | AA 1-198 |
Description : | The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
AA Sequence : | MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |
Purity : | > 95% as determined by SDS-PAGE |
Storage : | Stored and shipped at -80 centigrade |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | GUK1 guanylate kinase 1 [ Homo sapiens ] |
Official Symbol | GUK1 |
Synonyms | GUK1; guanylate kinase 1; guanylate kinase; GMP kinase; ATP:GMP phosphotransferase; GMK; FLJ42686; FLJ43710 |
Gene ID | 2987 |
mRNA Refseq | NM_000858 |
Protein Refseq | NP_000849 |
MIM | 139270 |
UniProt ID | Q16774 |
◆ Recombinant Proteins | ||
GUK1-4665H | Recombinant Human GUK1 protein | +Inquiry |
GUK1-3348HF | Recombinant Full Length Human GUK1 Protein, GST-tagged | +Inquiry |
GUK1-31H | Recombinant Human GUK1 Protein (AA 1-198), N-His-Tagged | +Inquiry |
GUK1-5223H | Recombinant Human GUK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GUK1-1841R | Recombinant Rhesus Macaque GUK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUK1-5674HCL | Recombinant Human GUK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUK1 Products
Required fields are marked with *
My Review for All GUK1 Products
Required fields are marked with *
0
Inquiry Basket