Recombinant Full Length Human GUK1 Protein, GST-tagged
| Cat.No. : | GUK1-3348HF |
| Product Overview : | Human GUK1 full-length ORF ( AAH06249, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 197 amino acids |
| Description : | The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
| Molecular Mass : | 47.41 kDa |
| AA Sequence : | MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GUK1 guanylate kinase 1 [ Homo sapiens ] |
| Official Symbol | GUK1 |
| Synonyms | GUK1; guanylate kinase 1; guanylate kinase; GMP kinase; ATP:GMP phosphotransferase; GMK; FLJ42686; FLJ43710; |
| Gene ID | 2987 |
| mRNA Refseq | NM_000858 |
| Protein Refseq | NP_000849 |
| MIM | 139270 |
| UniProt ID | Q16774 |
| ◆ Recombinant Proteins | ||
| GUK1-3952H | Recombinant Human GUK1 protein, His-tagged | +Inquiry |
| GUK1-5223H | Recombinant Human GUK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Guk1-1080M | Recombinant Mouse Guk1 Protein, MYC/DDK-tagged | +Inquiry |
| GUK1-4406H | Recombinant Human GUK1 protein, His-SUMO-tagged | +Inquiry |
| GUK1-3348HF | Recombinant Full Length Human GUK1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GUK1-5674HCL | Recombinant Human GUK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GUK1 Products
Required fields are marked with *
My Review for All GUK1 Products
Required fields are marked with *



