Recombinant Human GYPB Full Length Transmembrane protein, His-tagged

• Cat.No.: GYPB-4288H
• Product Overview: Recombinant Human GYPB protein(P06028)(20-91aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 20-91aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 10.5 kDa
• AA Sequence: LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GYPB glycophorin B (MNS blood group) [ Homo sapiens ]
• Official Symbol: GYPB
• Synonyms: GYPB; glycophorin B (MNS blood group); glycophorin B (includes Ss blood group) , glycophorin B (Ss blood group) , MNS; glycophorin-B; CD235b; GPB; SS; Ss blood group; glycophorin MiX; glycophorin HeP2; glycophorin MiVI; glycophorin MiIII; sialoglycoprotein delta; SS-active sialoglycoprotein; MNS; PAS-3; GPB.NY; HGpMiX; GpMiIII; HGpMiVI; GYPHe.NY; HGpMiIII
• Gene ID: 2994
• mRNA Refseq: NM_002100
• Protein Refseq: NP_002091
• UniProt ID: P06028