Recombinant Human GYPB Full Length Transmembrane protein, His-tagged
Cat.No. : | GYPB-4288H |
Product Overview : | Recombinant Human GYPB protein(P06028)(20-91aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-91aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 10.5 kDa |
AA Sequence : | LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GYPB glycophorin B (MNS blood group) [ Homo sapiens ] |
Official Symbol | GYPB |
Synonyms | GYPB; glycophorin B (MNS blood group); glycophorin B (includes Ss blood group) , glycophorin B (Ss blood group) , MNS; glycophorin-B; CD235b; GPB; SS; Ss blood group; glycophorin MiX; glycophorin HeP2; glycophorin MiVI; glycophorin MiIII; sialoglycoprotein delta; SS-active sialoglycoprotein; MNS; PAS-3; GPB.NY; HGpMiX; GpMiIII; HGpMiVI; GYPHe.NY; HGpMiIII; |
Gene ID | 2994 |
mRNA Refseq | NM_002100 |
Protein Refseq | NP_002091 |
UniProt ID | P06028 |
◆ Recombinant Proteins | ||
GYPB-3376HF | Recombinant Full Length Human GYPB Protein | +Inquiry |
GYPB-4509H | Recombinant Human GYPB Protein | +Inquiry |
RFL14875HF | Recombinant Full Length Human Glycophorin-B(Gypb) Protein, His-Tagged | +Inquiry |
GYPB-4288H | Recombinant Human GYPB Full Length Transmembrane protein, His-tagged | +Inquiry |
GYPB-4510H | Recombinant Human GYPB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYPB-313HCL | Recombinant Human GYPB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GYPB Products
Required fields are marked with *
My Review for All GYPB Products
Required fields are marked with *