Recombinant Human GYPB Protein, GST-tagged

• Cat.No.: GYPB-4510H
• Product Overview: Human GYPB partial ORF (NP_002091.2, 22 a.a. - 59 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Description: Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. GYPB gene consists of 5 exons and has 97% sequence homology with GYPA from the 5 UTR to the coding sequence encoding the first 45 amino acids. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 29.81 kDa
• AA Sequence: TTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GYPB glycophorin B (MNS blood group) [ Homo sapiens ]
• Official Symbol: GYPB
• Synonyms: GYPB; glycophorin B (MNS blood group); glycophorin B (includes Ss blood group) , glycophorin B (Ss blood group) , MNS; glycophorin-B; CD235b; GPB; SS; Ss blood group; glycophorin MiX; glycophorin HeP2; glycophorin MiVI; glycophorin MiIII; sialoglycoprotein delta; SS-active sialoglycoprotein; MNS; PAS-3; GPB.NY; HGpMiX; GpMiIII; HGpMiVI; GYPHe.NY; HGpMiIII
• Gene ID: 2994
• mRNA Refseq: NM_002100
• Protein Refseq: NP_002091
• UniProt ID: P06028