Recombinant Human H2AFZ protein, GST-tagged
| Cat.No. : | H2AFZ-3012H |
| Product Overview : | Recombinant Human H2AFZ protein(P0C0S5)(1-128aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-128aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.4 kDa |
| AA Sequence : | AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | H2AFZ H2A histone family, member Z [ Homo sapiens ] |
| Official Symbol | H2AFZ |
| Synonyms | H2AFZ; H2A histone family, member Z; H2AZ; histone H2A.Z; H2A.Z; H2AZ histone; H2A.z; H2A/z; MGC117173; |
| Gene ID | 3015 |
| mRNA Refseq | NM_002106 |
| Protein Refseq | NP_002097 |
| MIM | 142763 |
| UniProt ID | P0C0S5 |
| ◆ Recombinant Proteins | ||
| H2AFZ-2030R | Recombinant Rhesus monkey H2AFZ Protein, His-tagged | +Inquiry |
| H2AFZ-218HF | Recombinant Full Length Human H2AFZ Protein | +Inquiry |
| H2AFZ-5116H | Recombinant Human H2AFZ, His-tagged | +Inquiry |
| H2AFZ-1851R | Recombinant Rhesus Macaque H2AFZ Protein, His (Fc)-Avi-tagged | +Inquiry |
| H2AFZ-3406HF | Recombinant Full Length Human H2AFZ Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| H2AFZ-5655HCL | Recombinant Human H2AFZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H2AFZ Products
Required fields are marked with *
My Review for All H2AFZ Products
Required fields are marked with *
