Recombinant Human HAl, His-tagged
Cat.No. : | HAl-103H |
Product Overview : | Recombinant Human Histidase/HAL is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Leu657) of Human HAL fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-657 a.a. |
Description : | Histidase (HAL) belongs to the PAL/Histidase family. Histidase deaminates histidine to urocanic acid, the first step in histidine degradation. It is closely related to the plant enzyme phenylalanine ammonia-lyase , but is absent in plants and viruses. HAL contains a unique cofactor called 4-methylidene-imidazole-5-one group (MIO), which is produced autocatalytically by a cyclization and dehydration of the three amino-acid residues alanine, serine and glycine, for its chain folding. Defects in HAL are the cause of histidinemia (HISTID). HISTID is characterized by decreased urocanic acid as well as increased histamine and histidine in body fluids. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5 |
AA Sequence : | MPRYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKGLGLLD NEDRLEVALENNEFVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLG KGRYKIKLTPTAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTVIPINKLQELQVNLVRSHS SGVGKPLSPERCRMLLALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPL SHLALGLVGEGKMWSPKSGWADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASA IARQADIVAALTLEVLKGTTKAFDTDIHALRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDR VQDAYTLRCCPQVHGVVNDTIAFVKNIITTELNSATDNPMVFANRGETISGGNFHGEYPAKALDY LAIGIHELAAISERRIERLCNPSLSELPAFLVAEGGLNSGFMIAHCTAAALVSENKALCHPSSVD SLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAACQGIEFLRPLKTTTPLEKVYDLVRS VVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK IPESEDLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | HAL histidine ammonia-lyase [ Homo sapiens ] |
Official Symbol | HAl |
Synonyms | HAL; histidine ammonia-lyase; HIS; histidase; HSTD; |
Gene ID | 3034 |
mRNA Refseq | NM_001258333 |
Protein Refseq | NP_001245262 |
MIM | 609457 |
UniProt ID | P42357 |
Chromosome Location | 12q22-q24.1 |
Pathway | Histidine catabolism, organism-specific biosystem; Histidine metabolism, organism-specific biosystem; Histidine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; histidine degradation III, organism-specific biosystem; |
Function | ammonia-lyase activity; catalytic activity; histidine ammonia-lyase activity; lyase activity; |
◆ Recombinant Proteins | ||
Hal-1094M | Recombinant Mouse Hal Protein, MYC/DDK-tagged | +Inquiry |
HAL-2785R | Recombinant Rat HAL Protein | +Inquiry |
HAL-5250H | Recombinant Human HAL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HAL-2513H | Recombinant Human Histidine Ammonia-Lyase | +Inquiry |
HAL-2439R | Recombinant Rat HAL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAL-5641HCL | Recombinant Human HAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAL Products
Required fields are marked with *
My Review for All HAL Products
Required fields are marked with *
0
Inquiry Basket