Recombinant Human HDC protein(291-360 aa), C-His-tagged
| Cat.No. : | HDC-2680H |
| Product Overview : | Recombinant Human HDC protein(P19113)(291-360 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 291-360 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV |
| Gene Name | HDC histidine decarboxylase [ Homo sapiens ] |
| Official Symbol | HDC |
| Synonyms | HDC; histidine decarboxylase; MGC163399; |
| Gene ID | 3067 |
| mRNA Refseq | NM_002112 |
| Protein Refseq | NP_002103 |
| MIM | 142704 |
| UniProt ID | P19113 |
| ◆ Recombinant Proteins | ||
| HDC-988HFL | Recombinant Full Length Human HDC Protein, C-Flag-tagged | +Inquiry |
| HDC-4094M | Recombinant Mouse HDC Protein, His (Fc)-Avi-tagged | +Inquiry |
| HDC-5573C | Recombinant Chicken HDC | +Inquiry |
| HDC-5929Z | Recombinant Zebrafish HDC | +Inquiry |
| HDC-3070H | Recombinant Human HDC Protein (Met2-Gln477), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDC-5600HCL | Recombinant Human HDC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDC Products
Required fields are marked with *
My Review for All HDC Products
Required fields are marked with *
