Recombinant Human HDC protein(291-360 aa), C-His-tagged
Cat.No. : | HDC-2680H |
Product Overview : | Recombinant Human HDC protein(P19113)(291-360 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 291-360 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV |
Gene Name | HDC histidine decarboxylase [ Homo sapiens ] |
Official Symbol | HDC |
Synonyms | HDC; histidine decarboxylase; MGC163399; |
Gene ID | 3067 |
mRNA Refseq | NM_002112 |
Protein Refseq | NP_002103 |
MIM | 142704 |
UniProt ID | P19113 |
◆ Recombinant Proteins | ||
Hdc-497R | Recombinant Rat Hdc Protein, His-tagged | +Inquiry |
HDC-1057H | Recombinant Human HDC Protein, His (Fc)-Avi-tagged | +Inquiry |
HDC-7536M | Recombinant Mouse HDC Protein | +Inquiry |
HDC-4094M | Recombinant Mouse HDC Protein, His (Fc)-Avi-tagged | +Inquiry |
HDC-988HFL | Recombinant Full Length Human HDC Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDC-5600HCL | Recombinant Human HDC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDC Products
Required fields are marked with *
My Review for All HDC Products
Required fields are marked with *