Recombinant Full Length Human HDC Protein, C-Flag-tagged
Cat.No. : | HDC-988HFL |
Product Overview : | Recombinant Full Length Human HDC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the group II decarboxylase family and forms a homodimer that converts L-histidine to histamine in a pyridoxal phosphate dependent manner. Histamine regulates several physiologic processes, including neurotransmission, gastric acid secretion,inflamation, and smooth muscle tone. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 74 kDa |
AA Sequence : | MMEPEEYRERGREMVDYICQYLSTVRERRVMPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVV HWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSS QGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESCLNARLVAYASDQAHSSVEKAGLISLVKMKF LPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTA FLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQ IPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCTSQPSPRVGNL ISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGLHLETLLDPVDDCFSEEAPDA TKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPTEASVKNGGSSRVRIFSRFPEDMMMLKKSAF KKLIKFYSVPSFPECSSQCGLQLPCCPLQAMVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Histidine metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | HDC histidine decarboxylase [ Homo sapiens (human) ] |
Official Symbol | HDC |
Synonyms | MGC163399 |
Gene ID | 3067 |
mRNA Refseq | NM_002112.4 |
Protein Refseq | NP_002103.2 |
MIM | 142704 |
UniProt ID | P19113 |
◆ Recombinant Proteins | ||
HDC-2110H | Recombinant Human HDC Protein (1-662 aa), His-tagged | +Inquiry |
Hdc-496M | Recombinant Mouse Hdc Protein, His-tagged | +Inquiry |
HDC-5573C | Recombinant Chicken HDC | +Inquiry |
HDC-3070H | Recombinant Human HDC Protein (Met2-Gln477), C-His tagged | +Inquiry |
HDC-3435HF | Recombinant Full Length Human HDC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDC-5600HCL | Recombinant Human HDC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDC Products
Required fields are marked with *
My Review for All HDC Products
Required fields are marked with *
0
Inquiry Basket