Recombinant Human HERPUD2 Protein, GST-tagged
Cat.No. : | HERPUD2-4698H |
Product Overview : | Human HERPUD2 full-length ORF ( NP_071768.2, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HERPUD2 (HERPUD Family Member 2) is a Protein Coding gene. An important paralog of this gene is HERPUD1. |
Molecular Mass : | 71.6 kDa |
AA Sequence : | MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSRTPPSSPKSSTNRESHEALTSSSNSSSDHSGSTTPSSGQETLSLAVGSSSEGLRQRTLPQAQTDQAQSHQFPYVMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQMYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNLAHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPVLNEEDFNRDWLDWMYTFSRAAILLSIVYFYSSFSRFIMVMGAMLLVYLHQAGWFPFRQEGGHQQAPNNNAEVNNDGQNANNLELEEMERLMDDGLEDESGEDGGEDASAIQRPGLMASAWSFITTFFTSLIPEGPPQVAN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HERPUD2 HERPUD family member 2 [ Homo sapiens ] |
Official Symbol | HERPUD2 |
Synonyms | HERPUD2; HERPUD family member 2; homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein; FLJ22313; homocysteine inducible; endoplasmic reticulum stress inducible; ubiquitin like domain member 2; homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2; FLJ31032; |
Gene ID | 64224 |
mRNA Refseq | NM_022373 |
Protein Refseq | NP_071768 |
UniProt ID | Q9BSE4 |
◆ Cell & Tissue Lysates | ||
HERPUD2-5583HCL | Recombinant Human HERPUD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HERPUD2 Products
Required fields are marked with *
My Review for All HERPUD2 Products
Required fields are marked with *
0
Inquiry Basket