Recombinant Human HINT2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HINT2-4767H
Product Overview : HINT2 MS Standard C13 and N15-labeled recombinant protein (NP_115982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides.
Molecular Mass : 17.2 kDa
AA Sequence : MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HINT2 histidine triad nucleotide binding protein 2 [ Homo sapiens (human) ]
Official Symbol HINT2
Synonyms HINT2; histidine triad nucleotide binding protein 2; histidine triad nucleotide-binding protein 2, mitochondrial; HINT-2; HINT-3; HIT-17kDa; PKCI-1-related HIT protein; protein kinase C inhibitor-2; HIT-17;
Gene ID 84681
mRNA Refseq NM_032593
Protein Refseq NP_115982
MIM 609997
UniProt ID Q9BX68

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HINT2 Products

Required fields are marked with *

My Review for All HINT2 Products

Required fields are marked with *

0
cart-icon