Recombinant Human HINT2 Protein, GST-tagged
Cat.No. : | HINT2-4752H |
Product Overview : | Human HINT2 full-length ORF ( NP_115982.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM |
Molecular Mass : | 43.6 kDa |
AA Sequence : | MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HINT2 histidine triad nucleotide binding protein 2 [ Homo sapiens ] |
Official Symbol | HINT2 |
Synonyms | HINT2; histidine triad nucleotide binding protein 2; histidine triad nucleotide-binding protein 2, mitochondrial; HINT-2; HINT-3; HIT-17kDa; PKCI-1-related HIT protein; protein kinase C inhibitor-2; HIT-17; |
Gene ID | 84681 |
mRNA Refseq | NM_032593 |
Protein Refseq | NP_115982 |
MIM | 609997 |
UniProt ID | Q9BX68 |
◆ Recombinant Proteins | ||
HINT2-237H | Recombinant Human HINT2 Protein, MYC/DDK-tagged | +Inquiry |
HINT2-2082R | Recombinant Rhesus monkey HINT2 Protein, His-tagged | +Inquiry |
HINT2-4752H | Recombinant Human HINT2 Protein, GST-tagged | +Inquiry |
HINT2-1903R | Recombinant Rhesus Macaque HINT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HINT2-4767H | Recombinant Human HINT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT2-5557HCL | Recombinant Human HINT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT2 Products
Required fields are marked with *
My Review for All HINT2 Products
Required fields are marked with *
0
Inquiry Basket