Recombinant Human HMCES Protein, GST-Tagged

• Cat.No.: HMCES-0030H
• Product Overview: Human HMCES full-length ORF (NP_001006109.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HMCES (5-Hydroxymethylcytosine Binding, ES Cell Specific) is a Protein Coding gene. GO annotations related to this gene include peptidase activity.
• Molecular Mass: 67 kDa
• AA Sequence: MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMCES 5-hydroxymethylcytosine (hmC) binding, ES cell-specific [ Homo sapiens (human) ]
• Official Symbol: HMCES
• Synonyms: HMCES; 5-hydroxymethylcytosine (hmC) binding, ES cell-specific; C3ORF37; chromosome 3 open reading frame 37; UPF0361 protein C3orf37; DC12; MGC111075; SRAPD1; 5-Hydroxymethylcytosine Binding, ES Cell Specific; Embryonic Stem Cell-Specific 5-Hydroxymethylcytosine-Binding Protein; 5-Hydroxymethylcytosine (HmC) Binding, ES Cell-Specific; ES Cell-Specific 5hmC-Binding Protein; SRAP Domain-Containing Protein 1; Putative Peptidase SRAPD1; SOS Response Associated Peptidase Domain Containing 1; Chromosome 3 Open Reading Frame 37; UPF0361 Protein C3orf37; EC 3.4.-.-
• Gene ID: 56941
• mRNA Refseq: NM_001006109
• Protein Refseq: NP_001006109
• UniProt ID: Q96FZ2