Recombinant Human HMGA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HMGA1-5806H |
| Product Overview : | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. |
| Molecular Mass : | 11.7 kDa |
| AA Sequence : | MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HMGA1 high mobility group AT-hook 1 [ Homo sapiens (human) ] |
| Official Symbol | HMGA1 |
| Synonyms | HMGA1; high mobility group AT-hook 1; high mobility group (nonhistone chromosomal) protein isoforms I and Y, HMGIY; high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y; HMG-R; HMGIY; HMGA1A; MGC4242; MGC4854; MGC12816; |
| Gene ID | 3159 |
| mRNA Refseq | NM_145899 |
| Protein Refseq | NP_665906 |
| MIM | 600701 |
| UniProt ID | P17096 |
| ◆ Recombinant Proteins | ||
| HMGA1-5939C | Recombinant Chicken HMGA1 | +Inquiry |
| HMGA1-2520R | Recombinant Rat HMGA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HMGA1-1690H | Recombinant Human HMGA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HMGA1-7725M | Recombinant Mouse HMGA1 Protein | +Inquiry |
| HMGA1-4437H | Recombinant Human HMGA1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGA1-5480HCL | Recombinant Human HMGA1 293 Cell Lysate | +Inquiry |
| HMGA1-5479HCL | Recombinant Human HMGA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGA1 Products
Required fields are marked with *
My Review for All HMGA1 Products
Required fields are marked with *
