Recombinant Human HMX2 Protein, GST-tagged

• Cat.No.: HMX2-4889H
• Product Overview: Human HMX2 partial ORF (NP_005510.1, 125 a.a. - 224 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 125-224 a.a.
• Description: The protein encoded by this gene is a member of the NKL homeobox family of transcription factors. Members in this family are of ancient origin and play an important role in organ development during embryogenesis. A related mouse protein plays a role in patterning of inner ear structures. In humans, variations in a region containing this gene have been associated with inner ear malformations, vestibular dysfunction, and hearing loss. [provided by RefSeq, Aug 2012]
• Molecular Mass: 36.63 kDa
• AA Sequence: PAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERACLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMX2 H6 family homeobox 2 [ Homo sapiens ]
• Official Symbol: HMX2
• Synonyms: HMX2; H6 family homeobox 2; homeo box (H6 family) 2; homeobox protein HMX2; NKX5 2; H6 homeo box 2; homeobox (H6 family) 2; homeobox protein H6 family member 2; H6L; Nkx5-2
• Gene ID: 3167
• mRNA Refseq: NM_005519
• Protein Refseq: NP_005510
• MIM: 600647
• UniProt ID: A2RU54