Recombinant Human HNF4A
| Cat.No. : | HNF4A-28507TH |
| Product Overview : | Recombinant fragment of Human HNF4 (amino acids 324-423) with N terminal proprietary tag, 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP |
| Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
| Gene Name | HNF4A hepatocyte nuclear factor 4, alpha [ Homo sapiens ] |
| Official Symbol | HNF4A |
| Synonyms | HNF4A; hepatocyte nuclear factor 4, alpha; MODY, MODY1, TCF14; hepatocyte nuclear factor 4-alpha; HNF4; NR2A1; |
| Gene ID | 3172 |
| mRNA Refseq | NM_000457 |
| Protein Refseq | NP_000448 |
| MIM | 600281 |
| Uniprot ID | P41235 |
| Chromosome Location | 20q13.12 |
| Pathway | Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; |
| Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; activating transcription factor binding; fatty acid binding; fatty-acyl-CoA binding; |
| ◆ Recombinant Proteins | ||
| HNF4A-3312H | Recombinant Human HNF4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HNF4A-1852H | Recombinant Human HNF4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HNF4A-4895H | Recombinant Human HNF4A Protein, GST-tagged | +Inquiry |
| HNF4A-4255M | Recombinant Mouse HNF4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNF4A-9719Z | Recombinant Zebrafish HNF4A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNF4A-5458HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
| HNF4A-5457HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
| HNF4A-5459HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
| HNF4A-5456HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNF4A Products
Required fields are marked with *
My Review for All HNF4A Products
Required fields are marked with *



