Recombinant Human HNRNPA1 protein, His-tagged
Cat.No. : | HNRNPA1-3043H |
Product Overview : | Recombinant Human HNRNPA1 protein(P09651)(2-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-354aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.9 kDa |
AA Sequence : | SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 [ Homo sapiens ] |
Official Symbol | HNRNPA1 |
Synonyms | HNRNPA1; heterogeneous nuclear ribonucleoprotein A1; HNRPA1; hnRNP A1; hnRNPA1; hnRNP A1-like 3; hnRNP core protein A1; helix-destabilizing protein; hnRNP core protein A1-like 3; single-strand RNA-binding protein; single-strand DNA-binding protein UP1; nuclear ribonucleoprotein particle A1 protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein core protein A1; Putative heterogeneous nuclear ribonucleoprotein A1-like 3; HNRPA1L3; hnRNP-A1; MGC102835; |
Gene ID | 3178 |
mRNA Refseq | NM_002136 |
Protein Refseq | NP_002127 |
MIM | 164017 |
UniProt ID | P09651 |
◆ Recombinant Proteins | ||
HNRNPA1-3043H | Recombinant Human HNRNPA1 protein, His-tagged | +Inquiry |
HNRNPA1-2534R | Recombinant Rat HNRNPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPA1-4909H | Recombinant Human HNRNPA1 Protein, GST-tagged | +Inquiry |
HNRNPA1-454H | Recombinant Human HNRNPA1 Protein, His-tagged | +Inquiry |
Hnrnpa1-455M | Recombinant Mouse Hnrnpa1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPA1-5452HCL | Recombinant Human HNRNPA1 293 Cell Lysate | +Inquiry |
HNRNPA1-5453HCL | Recombinant Human HNRNPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA1 Products
Required fields are marked with *
My Review for All HNRNPA1 Products
Required fields are marked with *