Recombinant Human HNRNPA1 protein, His-tagged

• Cat.No.: HNRNPA1-3043H
• Product Overview: Recombinant Human HNRNPA1 protein(P09651)(2-354aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-354aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.9 kDa
• AA Sequence: SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 [ Homo sapiens ]
• Official Symbol: HNRNPA1
• Synonyms: HNRNPA1; heterogeneous nuclear ribonucleoprotein A1; HNRPA1; hnRNP A1; hnRNPA1; hnRNP A1-like 3; hnRNP core protein A1; helix-destabilizing protein; hnRNP core protein A1-like 3; single-strand RNA-binding protein; single-strand DNA-binding protein UP1; nuclear ribonucleoprotein particle A1 protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein core protein A1; Putative heterogeneous nuclear ribonucleoprotein A1-like 3; HNRPA1L3; hnRNP-A1; MGC102835
• Gene ID: 3178
• mRNA Refseq: NM_002136
• Protein Refseq: NP_002127
• MIM: 164017
• UniProt ID: P09651