Recombinant Human HNRNPA1 protein, His-tagged
| Cat.No. : | HNRNPA1-3043H |
| Product Overview : | Recombinant Human HNRNPA1 protein(P09651)(2-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-354aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.9 kDa |
| AA Sequence : | SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 [ Homo sapiens ] |
| Official Symbol | HNRNPA1 |
| Synonyms | HNRNPA1; heterogeneous nuclear ribonucleoprotein A1; HNRPA1; hnRNP A1; hnRNPA1; hnRNP A1-like 3; hnRNP core protein A1; helix-destabilizing protein; hnRNP core protein A1-like 3; single-strand RNA-binding protein; single-strand DNA-binding protein UP1; nuclear ribonucleoprotein particle A1 protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein core protein A1; Putative heterogeneous nuclear ribonucleoprotein A1-like 3; HNRPA1L3; hnRNP-A1; MGC102835; |
| Gene ID | 3178 |
| mRNA Refseq | NM_002136 |
| Protein Refseq | NP_002127 |
| MIM | 164017 |
| UniProt ID | P09651 |
| ◆ Recombinant Proteins | ||
| HNRNPA1-3033H | Recombinant Human HNRNPA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HNRNPA1-1939R | Recombinant Rhesus Macaque HNRNPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNRNPA1-2879R | Recombinant Rat HNRNPA1 Protein | +Inquiry |
| HNRNPA1-7756M | Recombinant Mouse HNRNPA1 Protein | +Inquiry |
| HNRNPA1-4257M | Recombinant Mouse HNRNPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPA1-5452HCL | Recombinant Human HNRNPA1 293 Cell Lysate | +Inquiry |
| HNRNPA1-5453HCL | Recombinant Human HNRNPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA1 Products
Required fields are marked with *
My Review for All HNRNPA1 Products
Required fields are marked with *
