Recombinant Human HNRNPA1 protein, His-tagged

Cat.No. : HNRNPA1-3043H
Product Overview : Recombinant Human HNRNPA1 protein(P09651)(2-354aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-354aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 40.9 kDa
AA Sequence : SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name HNRNPA1 heterogeneous nuclear ribonucleoprotein A1 [ Homo sapiens ]
Official Symbol HNRNPA1
Synonyms HNRNPA1; heterogeneous nuclear ribonucleoprotein A1; HNRPA1; hnRNP A1; hnRNPA1; hnRNP A1-like 3; hnRNP core protein A1; helix-destabilizing protein; hnRNP core protein A1-like 3; single-strand RNA-binding protein; single-strand DNA-binding protein UP1; nuclear ribonucleoprotein particle A1 protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein core protein A1; Putative heterogeneous nuclear ribonucleoprotein A1-like 3; HNRPA1L3; hnRNP-A1; MGC102835;
Gene ID 3178
mRNA Refseq NM_002136
Protein Refseq NP_002127
MIM 164017
UniProt ID P09651

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPA1 Products

Required fields are marked with *

My Review for All HNRNPA1 Products

Required fields are marked with *

0
cart-icon