Recombinant Human HNRNPA2B1 protein, His-tagged

• Cat.No.: HNRNPA2B1-3633H
• Product Overview: Recombinant Human HNRNPA2B1 protein(P22626)(1-353aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-353aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

Gene Information

• Gene Name: HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Homo sapiens ]
• Official Symbol: HNRNPA2B1
• Synonyms: HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; HNRPA2B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2 / hnRNP B1; nuclear ribonucleoprotein particle A2 protein; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; FLJ22720; DKFZp779B0244
• Gene ID: 3181
• mRNA Refseq: NM_002137
• Protein Refseq: NP_002128
• MIM: 600124
• UniProt ID: P22626