Recombinant Human HNRNPA2B1 protein, His-tagged
Cat.No. : | HNRNPA2B1-3633H |
Product Overview : | Recombinant Human HNRNPA2B1 protein(P22626)(1-353aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-353aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY |
Gene Name | HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Homo sapiens ] |
Official Symbol | HNRNPA2B1 |
Synonyms | HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; HNRPA2B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2 / hnRNP B1; nuclear ribonucleoprotein particle A2 protein; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; FLJ22720; DKFZp779B0244; |
Gene ID | 3181 |
mRNA Refseq | NM_002137 |
Protein Refseq | NP_002128 |
MIM | 600124 |
UniProt ID | P22626 |
◆ Recombinant Proteins | ||
HNRNPA2B1-3044H | Recombinant Human HNRNPA2B1 protein, His-B2M-tagged | +Inquiry |
HNRNPA2B1-5325H | Recombinant Human HNRNPA2B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNRNPA2B1-3045H | Recombinant Human HNRNPA2B1 protein, His-tagged | +Inquiry |
HNRNPA2B1-461H | Recombinant Human HNRNPA2B1 Protein, His-tagged | +Inquiry |
HNRNPA2B1-3633H | Recombinant Human HNRNPA2B1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPA2B1-334HCL | Recombinant Human HNRNPA2B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA2B1 Products
Required fields are marked with *
My Review for All HNRNPA2B1 Products
Required fields are marked with *