Recombinant Mouse Hnrnpa2b1 protein, His-tagged
Cat.No. : | Hnrnpa2b1-3046M |
Product Overview : | Recombinant Mouse Hnrnpa2b1 protein(O88569)(1-353aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-353aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.4 kDa |
AA Sequence : | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Hnrnpa2b1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Mus musculus ] |
Official Symbol | Hnrnpa2b1 |
Synonyms | HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2/B1; hnRNP A2 / hnRNP B1; heterogenous nuclear ribonucleoprotein A2/B1; Hnrpa2; hnrnp-A; Hnrpa2b1; 9130414A06Rik; |
Gene ID | 53379 |
mRNA Refseq | NM_016806 |
Protein Refseq | NP_058086 |
◆ Recombinant Proteins | ||
HNRNPA2B1-5325H | Recombinant Human HNRNPA2B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hnrnpa2b1-3047M | Recombinant Mouse Hnrnpa2b1 protein, His-SUMO & Myc-tagged | +Inquiry |
HNRNPA2B1-2119R | Recombinant Rhesus monkey HNRNPA2B1 Protein, His-tagged | +Inquiry |
HNRNPA2B1-786H | Recombinant Human HNRNPA2B1 protein, His&Myc-tagged | +Inquiry |
HNRNPA2B1-2196M | Recombinant Mouse HNRNPA2B1 Protein (1-353 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPA2B1-334HCL | Recombinant Human HNRNPA2B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hnrnpa2b1 Products
Required fields are marked with *
My Review for All Hnrnpa2b1 Products
Required fields are marked with *
0
Inquiry Basket