Recombinant Human HNRNPF
Cat.No. : | HNRNPF-27567TH |
Product Overview : | Recombinant full length Human hnRNP F with N terminal proprietary tag; Predicted MWt 71.72 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 415 amino acids |
Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs which have guanosine-rich sequences. This protein is very similar to the family member hnRPH. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Molecular Weight : | 71.720kDa inclusive of tags |
Tissue specificity : | Expressed ubiquitously. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGA AGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGH RYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPF GCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFA SQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLK FMSVQRPGPYDRPGTARRYIGIVKQAGLERMRPGAYSTGY GGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSE FTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIE IGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELF LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGC YGAGYSGQNSMGGYD |
Sequence Similarities : | Contains 3 RRM (RNA recognition motif) domains. |
Gene Name | HNRNPF heterogeneous nuclear ribonucleoprotein F [ Homo sapiens ] |
Official Symbol | HNRNPF |
Synonyms | HNRNPF; heterogeneous nuclear ribonucleoprotein F; HNRPF; |
Gene ID | 3185 |
mRNA Refseq | NM_001098204 |
Protein Refseq | NP_001091674 |
MIM | 601037 |
Uniprot ID | P52597 |
Chromosome Location | 10q11.21 |
Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; mRNA Processing, organism-specific biosystem; mRNA Splicing, organism-specific biosystem; |
Function | RNA binding; nucleotide binding; protein binding; single-stranded RNA binding; |
◆ Recombinant Proteins | ||
HNRNPF-236HF | Recombinant Full Length Human HNRNPF Protein | +Inquiry |
HNRNPF-5979H | Recombinant Human HNRNPF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNRNPF-1603H | Recombinant Human HNRNPF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNRNPF-4917H | Recombinant Human HNRNPF Protein, GST-tagged | +Inquiry |
HNRNPF-4463H | Recombinant Human HNRNPF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPF-5447HCL | Recombinant Human HNRNPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNRNPF Products
Required fields are marked with *
My Review for All HNRNPF Products
Required fields are marked with *
0
Inquiry Basket