Recombinant Human HOXC12 Protein, GST-tagged
Cat.No. : | HOXC12-4976H |
Product Overview : | Human HOXC12 partial ORF ( NP_776272, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXC12 homeobox C12 [ Homo sapiens ] |
Official Symbol | HOXC12 |
Synonyms | HOXC12; homeobox C12; HOC3F, homeo box C12 , HOX3, HOX3F; homeobox protein Hox-C12; homeo box 3F; homeo box C12; homeobox protein Hox-3F; HOX3; HOC3F; HOX3F; |
Gene ID | 3228 |
mRNA Refseq | NM_173860 |
Protein Refseq | NP_776272 |
MIM | 142975 |
UniProt ID | P31275 |
◆ Recombinant Proteins | ||
HOXC12-7806M | Recombinant Mouse HOXC12 Protein | +Inquiry |
HOXC12-4290M | Recombinant Mouse HOXC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
HOXC12-4976H | Recombinant Human HOXC12 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HOXC12 Products
Required fields are marked with *
My Review for All HOXC12 Products
Required fields are marked with *