Recombinant Human HPCA protein(2-193aa), His&Myc-tagged
| Cat.No. : | HPCA-329H |
| Product Overview : | Recombinant Human HPCA protein(P84074)(2-193aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 2-193aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.7 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF |
| Gene Name | HPCA hippocalcin [ Homo sapiens ] |
| Official Symbol | HPCA |
| Synonyms | HPCA; hippocalcin; neuron-specific calcium-binding protein hippocalcin; calcium-binding protein BDR-2; neuron specific calcium-binding protein hippocalcin; BDR2; |
| Gene ID | 3208 |
| mRNA Refseq | NM_002143 |
| Protein Refseq | NP_002134 |
| MIM | 142622 |
| UniProt ID | P84074 |
| ◆ Recombinant Proteins | ||
| HPCA-2897R | Recombinant Rat HPCA Protein | +Inquiry |
| HPCA-7824M | Recombinant Mouse HPCA Protein | +Inquiry |
| HPCA-1742H | Recombinant Human HPCA protein, His & T7-tagged | +Inquiry |
| HPCA-2136R | Recombinant Rhesus monkey HPCA Protein, His-tagged | +Inquiry |
| HPCA-2552R | Recombinant Rat HPCA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HPCA-815HCL | Recombinant Human HPCA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPCA Products
Required fields are marked with *
My Review for All HPCA Products
Required fields are marked with *



