"HPS3" Related Products

Expand

Recombinant Human HPS3 Protein, GST-tagged

Cat.No.: HPS3-5015H
Product Overview: Human HPS3 full-length ORF ( AAH16901.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a protein containing a potential clathrin-binding motif, consensus dileucine signals, and tyrosine-based sorting signals for targeting to vesicles of lysosomal lineage. The encoded protein may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 3. Alternate splice variants exist, but their full length sequence has not been determined. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 68.7 kDa
AA Sequence: MFYVAEPKQVPHILCSPSMKNINPLTAMSYLRKLDTSGFSSILVTLTKAAVALKMGDLDMHRNEMKSHSEMKLVCGFILEPRLLIQQRKGQIVPTELALHLKETQPGLLVASVLGLQKNNKIGIEEADSFFKVLCAKDEDTIPQLLVDFWEAQLVACLPDVVLQELFFKLTSQYIWRLSKRQPPDTTPLRTSEDLINACSHYGLIYPWVHVVISSDSLADKNYTEDLSKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLT
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: HPS3 Hermansky-Pudlak syndrome 3 [ Homo sapiens ]
Official Symbol: HPS3
Synonyms: HPS3; Hermansky-Pudlak syndrome 3; Hermansky-Pudlak syndrome 3 protein; SUTAL; FLJ22704; DKFZp686F0413;
Gene ID: 84343
mRNA Refseq: NM_032383
Protein Refseq: NP_115759
MIM: 606118
UniProt ID: Q969F9

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.