Recombinant Human HPS6 Protein, GST-tagged
| Cat.No. : | HPS6-5018H |
| Product Overview : | Human HPS6 partial ORF ( NP_079023, 400 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6. [provided by RefSeq |
| Molecular Mass : | 36.85 kDa |
| AA Sequence : | KDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HPS6 Hermansky-Pudlak syndrome 6 [ Homo sapiens ] |
| Official Symbol | HPS6 |
| Synonyms | HPS6; Hermansky-Pudlak syndrome 6; Hermansky-Pudlak syndrome 6 protein; FLJ22501; ruby-eye protein homolog; Hermansky-Pudlak syndrome-6 protein (HPS6); MGC20522; RP11-302K17.1; |
| Gene ID | 79803 |
| mRNA Refseq | NM_024747 |
| Protein Refseq | NP_079023 |
| MIM | 607522 |
| UniProt ID | Q86YV9 |
| ◆ Recombinant Proteins | ||
| HPS6-4311M | Recombinant Mouse HPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HPS6-2906R | Recombinant Rat HPS6 Protein | +Inquiry |
| HPS6-3627H | Recombinant Human HPS6 protein, GST-tagged | +Inquiry |
| HPS6-5018H | Recombinant Human HPS6 Protein, GST-tagged | +Inquiry |
| HPS6-7837M | Recombinant Mouse HPS6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HPS6 Products
Required fields are marked with *
My Review for All HPS6 Products
Required fields are marked with *
