Recombinant Human HPS6 Protein, GST-tagged

Cat.No. : HPS6-5018H
Product Overview : Human HPS6 partial ORF ( NP_079023, 400 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6. [provided by RefSeq
Molecular Mass : 36.85 kDa
AA Sequence : KDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTMLRTELRDYRGLEQLKAQLVAGDDEEAGWTELAEQEVARLLRTELIG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HPS6 Hermansky-Pudlak syndrome 6 [ Homo sapiens ]
Official Symbol HPS6
Synonyms HPS6; Hermansky-Pudlak syndrome 6; Hermansky-Pudlak syndrome 6 protein; FLJ22501; ruby-eye protein homolog; Hermansky-Pudlak syndrome-6 protein (HPS6); MGC20522; RP11-302K17.1;
Gene ID 79803
mRNA Refseq NM_024747
Protein Refseq NP_079023
MIM 607522
UniProt ID Q86YV9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HPS6 Products

Required fields are marked with *

My Review for All HPS6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon