Recombinant Human HRH4 Protein, GST-tagged

Cat.No. : HRH4-5038H
Product Overview : Human HRH4 partial ORF ( NP_067637, 194 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 37.95 kDa
AA Sequence : NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HRH4 histamine receptor H4 [ Homo sapiens ]
Official Symbol HRH4
Synonyms HRH4; histamine receptor H4; histamine H4 receptor; AXOR35; GPCR105; GPRv53; H4R; HH4R; SP9144; pfi-013; G-protein coupled receptor 105; H4; BG26; MGC133027;
Gene ID 59340
mRNA Refseq NM_001143828
Protein Refseq NP_001137300
MIM 606792
UniProt ID Q9H3N8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HRH4 Products

Required fields are marked with *

My Review for All HRH4 Products

Required fields are marked with *

0
cart-icon