Recombinant Human HSD17B2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HSD17B2-1364H |
Product Overview : | HSD17B2 MS Standard C13 and N15-labeled recombinant protein (NP_002144) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HSD17B2 hydroxysteroid 17-beta dehydrogenase 2 [ Homo sapiens (human) ] |
Official Symbol | HSD17B2 |
Synonyms | HSD17B2; hydroxysteroid (17-beta) dehydrogenase 2; estradiol 17-beta-dehydrogenase 2; HSD17; SDR9C2; short chain dehydrogenase/reductase family 9C; member 2; E2DH; 20-alpha-HSD; 17-beta-HSD 2; testosterone 17-beta-dehydrogenase; 20 alpha-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase type 2; microsomal 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 9C, member 2; EDH17B2; |
Gene ID | 3294 |
mRNA Refseq | NM_002153 |
Protein Refseq | NP_002144 |
MIM | 109685 |
UniProt ID | P37059 |
◆ Recombinant Proteins | ||
HSD17B2-6951HF | Recombinant Full Length Human HSD17B2 Protein, GST-tagged | +Inquiry |
HSD17B2-4334M | Recombinant Mouse HSD17B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hsd17b2-1178M | Recombinant Mouse Hsd17b2 Protein, MYC/DDK-tagged | +Inquiry |
HSD17B2-206H | Recombinant Human HSD17B2, GST-tagged | +Inquiry |
HSD17B2-1364H | Recombinant Human HSD17B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B2-5375HCL | Recombinant Human HSD17B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD17B2 Products
Required fields are marked with *
My Review for All HSD17B2 Products
Required fields are marked with *