Recombinant Human HTR1B Protein, GST-tagged
Cat.No. : | HTR1B-5251H |
Product Overview : | Human HTR1B partial ORF ( NP_000854, 1 a.a. - 49 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The neurotransmitter serotonin (5-hydroxytryptamine; 5-HT) exerts a wide variety of physiologic functions through a multiplicity of receptors and may be involved in human neuropsychiatric disorders such as anxiety, depression, or migraine. These receptors consist of 4 main groups, 5-HT-1, 5-HT-2, 5-HT-3, and 5-HT4, subdivided into several distinct subtypes on the basis of their pharmacologic characteristics, coupling to intracellular second messengers, and distribution within the nervous system (Zifa and Fillion, 1992 [PubMed 1359584]). The serotonergic receptors belong to the multigene family of receptors coupled to guanine nucleotide-binding proteins.[supplied by OMIM |
Molecular Mass : | 31.13 kDa |
AA Sequence : | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTR1B 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR1B |
Synonyms | HTR1B; 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1B; 5-hydroxytryptamine receptor 1B; 5 HT1B; 5 HT1DB; HTR1D2; S12; 5-HT-1B; 5-HT-1D-beta; serotonin receptor 1B; serotonin 1D beta receptor; 5-HT1B; HTR1DB; 5-HT1DB; |
Gene ID | 3351 |
mRNA Refseq | NM_000863 |
Protein Refseq | NP_000854 |
MIM | 182131 |
UniProt ID | P28222 |
◆ Recombinant Proteins | ||
HTR1B-6992Z | Recombinant Zebrafish HTR1B | +Inquiry |
HTR1B-5251H | Recombinant Human HTR1B Protein, GST-tagged | +Inquiry |
HTR1B-7929M | Recombinant Mouse HTR1B Protein | +Inquiry |
HTR1B-4372M | Recombinant Mouse HTR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32732RF | Recombinant Full Length Rat 5-Hydroxytryptamine Receptor 1B(Htr1B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR1B-5337HCL | Recombinant Human HTR1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR1B Products
Required fields are marked with *
My Review for All HTR1B Products
Required fields are marked with *
0
Inquiry Basket