Recombinant Human HTR3E Transmembrane protein (72-228 aa & 241-456 aa), His-SUMO-tagged

Cat.No. : HTR3E-2714H
Product Overview : Recombinant Human HTR3E Protein (72-228 aa & 241-456 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 72-228aa&241-456aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 58.2kDa
AA Sequence : MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name HTR3E 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic [ Homo sapiens ]
Official Symbol HTR3E
Synonyms HTR3E; 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3, family member E; 5-hydroxytryptamine receptor 3E; 5-hydroxytryptamine receptor 3 subunit E; 5-hydroxytryptamine (serotonin) receptor 3, family member E; 5-HT3E; 5-HT3-E; 5-HT3c1; MGC120035; MGC120036; MGC120037;
Gene ID 285242
mRNA Refseq NM_001256613
Protein Refseq NP_001243542
MIM 610123
UniProt ID A5X5Y0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HTR3E Products

Required fields are marked with *

My Review for All HTR3E Products

Required fields are marked with *

0
cart-icon