Recombinant Human HTR3E Transmembrane protein (72-228 aa & 241-456 aa), His-SUMO-tagged
| Cat.No. : | HTR3E-2714H |
| Product Overview : | Recombinant Human HTR3E Protein (72-228 aa & 241-456 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 72-228aa&241-456aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 58.2kDa |
| AA Sequence : | MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HTR3E 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic [ Homo sapiens ] |
| Official Symbol | HTR3E |
| Synonyms | HTR3E; 5-hydroxytryptamine (serotonin) receptor 3E, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3, family member E; 5-hydroxytryptamine receptor 3E; 5-hydroxytryptamine receptor 3 subunit E; 5-hydroxytryptamine (serotonin) receptor 3, family member E; 5-HT3E; 5-HT3-E; 5-HT3c1; MGC120035; MGC120036; MGC120037; |
| Gene ID | 285242 |
| mRNA Refseq | NM_001256613 |
| Protein Refseq | NP_001243542 |
| MIM | 610123 |
| UniProt ID | A5X5Y0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HTR3E Products
Required fields are marked with *
My Review for All HTR3E Products
Required fields are marked with *



