Recombinant Human IARS protein, His&Myc-tagged

Cat.No. : IARS-4313H
Product Overview : Recombinant Human IARS protein(P41252)(693-852aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 693-852aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.3 kDa
AA Sequence : DRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKTIPIKYPLKEIVV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name IARS isoleucyl-tRNA synthetase [ Homo sapiens ]
Official Symbol IARS
Synonyms IARS; isoleucyl-tRNA synthetase; isoleucine--tRNA ligase, cytoplasmic; IARS1; ILRS; isoleucine tRNA ligase 1; cytoplasmic; isoleucine tRNA ligase 1, cytoplasmic; isoleucyl-tRNA synthetase, cytoplasmic; IRS; ILERS; PRO0785; FLJ20736;
Gene ID 3376
mRNA Refseq NM_002161
Protein Refseq NP_002152
MIM 600709
UniProt ID P41252

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IARS Products

Required fields are marked with *

My Review for All IARS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon